PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00175.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 646aa    MW: 69599.1 Da    PI: 8.6753
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00175.1.g00210.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32330387260
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                   dDgynWrKYGqK++kgse+prsYY+Ct+++Cp+kkk+ers  d++v+ei+Y+g+Hnh+k
  Zpz_sc00175.1.g00210.1.am.mk 330 DDGYNWRKYGQKQMKGSENPRSYYKCTFPDCPTKKKMERSP-DGQVTEIVYKGTHNHPK 387
                                   8****************************************.***************85 PP

2WRKY100.69.1e-32494552159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vkg+++prsYY+Ct agCpv+k+ver+ +d ++v++tYe +Hnh+
  Zpz_sc00175.1.g00210.1.am.mk 494 LDDGYRWRKYGQKVVKGNPNPRSYYKCTAAGCPVRKHVERACHDARAVITTYEAKHNHD 552
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-27321388IPR003657WRKY domain
SuperFamilySSF1182902.88E-24326388IPR003657WRKY domain
SMARTSM007741.5E-33329387IPR003657WRKY domain
PfamPF031062.8E-24330386IPR003657WRKY domain
PROSITE profilePS5081122.997330388IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-35479554IPR003657WRKY domain
SuperFamilySSF1182902.88E-28486554IPR003657WRKY domain
PROSITE profilePS5081137.849489554IPR003657WRKY domain
SMARTSM007746.8E-36494553IPR003657WRKY domain
PfamPF031062.3E-24495552IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MIVTTTLTNR ASNPIHGEER STKRFAAATP SAHRTRTRSG TGHCFDAHVS GLPRSHWRVA  60
VGSGVVFRAP ITFDRSTVRD SNVYKRGWES CRRDTPRPAL RRPVLPARYS PAMSVSPPSH  120
MTSAPASLGA AVANSGPVAL SFASNSFGGG SSFLAGGSRF KYMAPVSLLP ASPSSRFNAA  180
AAGGFLDSPI LLTPSLFPSP TTGAFPSEPF NWMGPPAENL PEVVKEEQRQ CFDFTFQTTA  240
AVPVTTTGAA QAESFSQSSM TMAPLGAEGD SYNGEPWSFQ QERAMDFNAP FEAPSSGVTT  300
AVTQPADMLR NSGYNAPPCF REQQSRRSSD DGYNWRKYGQ KQMKGSENPR SYYKCTFPDC  360
PTKKKMERSP DGQVTEIVYK GTHNHPKPQG TRRGAASAAS YVLGSANDEH SFGALSGTPV  420
ATPENSSGSF GDDEINGVSS RLIGTDQLLH ADDEPDSKKC RRDGSEGEAL SVAGNRRVRE  480
PRVVVQTMSD IDVLDDGYRW RKYGQKVVKG NPNPRSYYKC TAAGCPVRKH VERACHDARA  540
VITTYEAKHN HDVPPARGSY RAGLTALQPA ASYHQGAGVF VGASSHGAPM QAAESGGFAL  600
SGFGNTMGAS YPYTTSQQCD ATYYTSGTKD EPRDDDLSFF EQQLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-33330554877Probable WRKY transcription factor 4
2lex_A1e-33330554877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981841e-101DQ298184.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 70 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961763.10.0PREDICTED: probable WRKY transcription factor 25
TrEMBLK3Z5160.0K3Z516_SETIT; Uncharacterized protein
STRINGSi021634m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-92WRKY DNA-binding protein 33